PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK35828.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Dof
Protein Properties Length: 179aa    MW: 19832.9 Da    PI: 8.896
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK35828.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.8e-392786261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                ++++lkcprCds+ntkfCyynny+lsqPr++Ck+CrryWtkGG+lrn+PvGgg+rkn+k+
  KFK35828.1 27 EQEHLKCPRCDSSNTKFCYYNNYNLSQPRHYCKSCRRYWTKGGSLRNIPVGGGSRKNNKK 86
                57899***************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.3E-332985IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1893185IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-203276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MQDLTSAAAT YYHHQSLPQQ PPELLPEQEH LKCPRCDSSN TKFCYYNNYN LSQPRHYCKS  60
CRRYWTKGGS LRNIPVGGGS RKNNKKPGSG SGSGSSSSNK TISVSDQRQE EEKSNSGQEM  120
DPTRMLYGLP VGAPSFSSLL ASNMYGTGSA RWYPGLGSGI EKSGDDTWTD LVMYRVEKN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002891653.12e-73hypothetical protein ARALYDRAFT_474287
SwissprotO821555e-75DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A087H1261e-132A0A087H126_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.1__4241__AT1G51700.15e-73(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-57DOF zinc finger protein 1